NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI10215J12807_1020301

Scaffold JGI10215J12807_1020301


Overview

Basic Information
Taxon OID3300000881 Open in IMG/M
Scaffold IDJGI10215J12807_1020301 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Wisconsin Restored Prairie soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)936
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameWisconsin, USA
CoordinatesLat. (o)43.303611Long. (o)-89.332778Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097649Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
JGI10215J12807_10203011F097649AGGAGMIDEEAMNSVTEKKSSGRPSILTKDVMAGIPVLVQQGLTAEAIAARLGCTVGTLKVRCSQAQISLRVPKEVKVVPLVPLAPVPTTPKSSQSKRCFAFAVPTTLQLSRVAMSRLR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.