Basic Information | |
---|---|
Taxon OID | 3300000878 Open in IMG/M |
Scaffold ID | AL9A1W_1366776 Open in IMG/M |
Source Dataset Name | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1191 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Axel Heiberg Island, Nunavut, Canada | |||||||
Coordinates | Lat. (o) | 79.26 | Long. (o) | -90.46 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010655 | Metagenome / Metatranscriptome | 301 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
AL9A1W_13667762 | F010655 | AGG | MQVSQVAYDRFVLELPAADNEWKPLADPELVAETAAWLWDFGPTPLIGVVGYDKTGAAPAWLSRWQSRQVSWAPDGTTAGRAVILADQTDLERFLAAGAPHEHTALLWPAVSDAKTFEALVSGGAAWLRTVDAHARIMRNGEVFELTQTSPQSN* |
⦗Top⦘ |