Basic Information | |
---|---|
Taxon OID | 3300000867 Open in IMG/M |
Scaffold ID | EsTDRAFT_1082622 Open in IMG/M |
Source Dataset Name | Estuary microbial communities from the Columbia River - metatranscriptome 5 PSU |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 554 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River estuary | |||||||
Coordinates | Lat. (o) | 46.235 | Long. (o) | -123.91 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023573 | Metagenome | 209 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
EsTDRAFT_10826223 | F023573 | GAG | MLTLVSTTGEYNCTAVIQGPMGVIRICDLVWCPADRMDLLEIYYWESYAVLQGAYHCCFSIPGKVSLLKP |
⦗Top⦘ |