NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold EsTDRAFT_1004509

Scaffold EsTDRAFT_1004509


Overview

Basic Information
Taxon OID3300000867 Open in IMG/M
Scaffold IDEsTDRAFT_1004509 Open in IMG/M
Source Dataset NameEstuary microbial communities from the Columbia River - metatranscriptome 5 PSU
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3877
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River estuary
CoordinatesLat. (o)46.235Long. (o)-123.91Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044445Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
EsTDRAFT_10045099F044445N/AMRQLVYNAVTCTECKELLVSYHRHDYKTCNCPNEAMVDGGLDYERYGAKDMDKLILNHYYADDPFDLVRCYATRGSRGEDGKQPLTWIPLKDMDDDYLEAVLEYGGADWHLDVAPPLEIGRSDGRCVQRA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.