Scaffold JGI10213J12805_10569739

Overview

Basic Information

• Taxon OID: 3300000858
• Scaffold ID: JGI10213J12805_10569739
• Source Dataset Name: Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 550
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. CB01531 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.312222
  • Long. (^o): -89.370833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087715	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI10213J12805_105697392	F087715	GGA	VTEPHNWPLEQSAEGTLRPWYLTATGYLMVLFSHPEEAQRAHCGLRDHKVSQEDIRLYESEEILRILARAQKE