Scaffold JGI10213J12805_10071389

Overview

Basic Information

• Taxon OID: 3300000858
• Scaffold ID: JGI10213J12805_10071389
• Source Dataset Name: Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 759
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.312222
  • Long. (^o): -89.370833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005957	Metagenome / Metatranscriptome	385	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI10213J12805_100713891	F005957	GGAG	MITRSERSASTGLHALVAAIKRSPIVTRLSGGLSRAAQWARVRKSPDVDAFVLAWIASQARDARRRPRYFM*