Scaffold AP72_2010_repI_A100DRAFT_1009346

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold AP72_2010_repI_A100DRAFT_1009346

Scaffold AP72_2010_repI_A100DRAFT_1009346

Overview

Basic Information
Taxon OID	3300000837 Open in IMG/M
Scaffold ID	AP72_2010_repI_A100DRAFT_1009346 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1385
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location
Location Name	Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
Coordinates	Lat. (^o)	-10.171667	Long. (^o)	-62.7875	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014548	Metagenome / Metatranscriptome	262	Y

Sequences

Protein ID	Family	RBS	Sequence
AP72_2010_repI_A100DRAFT_10093462	F014548	N/A	IDKSLYVDAALVGCGHVSGLLMRRGWPLALMLXADQVPIVHTHSKMR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.