Scaffold AP72_2010_repI_A100DRAFT_1004862

Overview

Basic Information

• Taxon OID: 3300000837
• Scaffold ID: AP72_2010_repI_A100DRAFT_1004862
• Source Dataset Name: Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1897
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location

• Location Name: Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
• Coordinates
  • Lat. (^o): -10.171667
  • Long. (^o): -62.7875

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046295	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
AP72_2010_repI_A100DRAFT_10048621	F046295	N/A	ELIARPFNKETLRRGVIPEFLHSIGITPSWFRDRAVRRNEAVGPFTVSVAREVLRSIGKEMTWLQAKKCKVEFAGYLRQNNCTDAGYCGLSTMLARHIEEELRCDNDGFAQGVWGKGWADVFAADVTEQFTPNDFEVRQPDWFTARRLTRAIGKMTDFARQTLLDPALAVEAPWNDVAYRSGLVSRD*