Scaffold JGI12396J12026_1111820

Overview

Basic Information

• Taxon OID: 3300000827
• Scaffold ID: JGI12396J12026_1111820
• Source Dataset Name: Soil microbial communities from Moab, Utah, sample - Soil Crust Prior wet up (biological replicate B) 0B (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 501
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Sphaeropleales → Selenastraceae → Monoraphidium → Monoraphidium neglectum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location

• Location Name: Moab, Utah
• Coordinates
  • Lat. (^o): 38.714694
  • Long. (^o): -109.692944

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020088	Metagenome / Metatranscriptome	226	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12396J12026_11118201	F020088	N/A	EQRAAKQPSRFRIEKLEERIAPAIVLTNPGGNTPQGGGANNGQAIEARNPAGQAPPGQNK