Scaffold JGI12396J12026_1033777

Overview

Basic Information

• Taxon OID: 3300000827
• Scaffold ID: JGI12396J12026_1033777
• Source Dataset Name: Soil microbial communities from Moab, Utah, sample - Soil Crust Prior wet up (biological replicate B) 0B (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1077
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location

• Location Name: Moab, Utah
• Coordinates
  • Lat. (^o): 38.714694
  • Long. (^o): -109.692944

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001042	Metagenome / Metatranscriptome	794	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12396J12026_10337772	F001042	AGGCGG	MTTSHLIGGNFASTIPKDFEADTDDKIVIDKLLINKLTELLITSIYNVHTSRRSEIFLTSLDMHLAEYSISNKNDTACREFTEKSSLLLESYQEDVPKSLGKAESCLGEAIDLINLIVSASEAEANNG*