Scaffold JGI1027J11758_13042948

Overview

Basic Information

• Taxon OID: 3300000789
• Scaffold ID: JGI1027J11758_13042948
• Source Dataset Name: Soil microbial communities from Great Prairies - Iowa, Native Prairie soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 527
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Thiomicrospira → Thiomicrospira cyclica (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084650	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI1027J11758_130429481	F084650	N/A	VLFISTEDPNLNAGRILVRMSRGGQAVPLGAIPESYEEAMKSLPQARRHADDLLVYDNTPNGKGHRLVARFIAGELVKTTHSAPEWLKGVFGRELLSESKXQEKSTRGR*