Basic Information | |
---|---|
Taxon OID | 3300000754 Open in IMG/M |
Scaffold ID | JGI11851J11668_1007372 Open in IMG/M |
Source Dataset Name | Amended soil microbial communities from Kansas Great Prairies, USA - acetate Total DNA F2.4TB |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 502 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kanza Prairie, Kansas, USA | |||||||
Coordinates | Lat. (o) | 39.100992 | Long. (o) | -96.608258 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069375 | Metagenome / Metatranscriptome | 124 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI11851J11668_10073721 | F069375 | N/A | ASMRRKLFALSGLLATFLLASMASGTAAAPLVEQFHGTFSETIPDDNLCGIDGTSVISGMDNIQVFADDTFKDQFRLNQTFTSAATGKSVLFFIAQQFKSVGPPIDNGDGTITFVSTFKGLPQKVKLPNGAVLVRDAGFAQFNATFDATTDEFLGETHTPVNGPHPI |
⦗Top⦘ |