| Basic Information | |
|---|---|
| Taxon OID | 3300000730 Open in IMG/M |
| Scaffold ID | fpDRAFT_1006756 Open in IMG/M |
| Source Dataset Name | Illumina Fosmids (spades contigs) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Illumina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10355 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Activated Sludge → Activated Sludge Microbial Communities From San Jose - Santa Clara Water Pollution Control Plant, Ca |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | San Jose/Santa Clara Water Pollution Control Plant | |||||||
| Coordinates | Lat. (o) | 37.434249 | Long. (o) | -121.946397 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006745 | Metagenome | 365 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| fpDRAFT_10067564 | F006745 | AGG | VRASDRRRTSSSAVAVYVIILMGFQVFLVTVAVEAFMTDTEELAWATAGVSVALFGLSVAFLRYLRP* |
| ⦗Top⦘ |