Scaffold KanNP_Total_F14TBDRAFT_1005953

Overview

Basic Information

• Taxon OID: 3300000709
• Scaffold ID: KanNP_Total_F14TBDRAFT_1005953
• Source Dataset Name: Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 847
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029703	Metagenome	187	N

Sequences

Protein ID	Family	RBS	Sequence
KanNP_Total_F14TBDRAFT_10059532	F029703	GAG	MSTDEPVRTDYEFLKGVDYIFLSLDRNLSGEECHELAEKYFETHKGMTLPGQALRVAML*