 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300000651 Open in IMG/M |
| Scaffold ID | AP72_2010_repI_A10DRAFT_1005414 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1736 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil | |||||||
| Coordinates | Lat. (o) | -10.171667 | Long. (o) | -62.7875 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037451 | Metagenome / Metatranscriptome | 168 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| AP72_2010_repI_A10DRAFT_10054142 | F037451 | N/A | MANRPANLRNDAMSRNELRELQRSLRLLSPMIVKEKYKVLADRCRFLELPTPRLMQEFVATWKVLWKWRR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |