| Basic Information | |
|---|---|
| Taxon OID | 3300000580 Open in IMG/M |
| Scaffold ID | AF_2010_repII_A01DRAFT_1016485 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1182 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil | |||||||
| Coordinates | Lat. (o) | -10.171667 | Long. (o) | -62.7875 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032025 | Metagenome / Metatranscriptome | 181 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| AF_2010_repII_A01DRAFT_10164852 | F032025 | GAG | MDQQDNISILGPRDDGTYVVEFRTAEGKKLAITVPGTKAEVLKHFQAATARLHAPTSDESAMNGILKPKIRNILKTGWTVARGIIELAIMVYVLGAILDPADTIIVAVLGIIYAAIRSAALFQYFTITQMAWASDRQSLEQGRLGEDPNVDREIANTDASMSRILINCYIAGAFIALQYLVCLIYIFSKLRTVL* |
| ⦗Top⦘ |