Scaffold SL_7KL_010_BRINEDRAFT_10024065

Overview

Basic Information

• Taxon OID: 3300000576
• Scaffold ID: SL_7KL_010_BRINEDRAFT_10024065
• Source Dataset Name: Alkaline brine water microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 7KL_010_BRINE
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2725
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location

• Location Name: Russia: Kulunda Steppe, Lake Tanatar
• Coordinates
  • Lat. (^o): 51.37
  • Long. (^o): 79.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026202	Metagenome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
SL_7KL_010_BRINEDRAFT_100240651	F026202	N/A	MVSCNAASKATAVATVLSMGSLELLLRAIVFTLLDLNEMVGTTLPREVLGASLSGLVSCGWCWGSAS