Scaffold SL_4KL_010_BRINEDRAFT_10225572

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SL_4KL_010_BRINEDRAFT_10225572

Scaffold SL_4KL_010_BRINEDRAFT_10225572

Overview

Basic Information
Taxon OID	3300000575 Open in IMG/M
Scaffold ID	SL_4KL_010_BRINEDRAFT_10225572 Open in IMG/M
Source Dataset Name	Alkaline brine water microbial communities from Picturesque Lake, Kulunda Steppe, Russia - 4KL_010_BRINE
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	500
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location Name	Russia: Kulunda Steppe, Picturesque Lake
Coordinates	Lat. (^o)	51.43	Long. (^o)	79.52	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026202	Metagenome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
SL_4KL_010_BRINEDRAFT_102255721	F026202	N/A	MNDMKNIVSCNAASKVTMLSMGTLELLLRASVFTVLDLNEMGDTALPREVPGASLSRPVSCGW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.