Basic Information | |
---|---|
Taxon OID | 3300000575 Open in IMG/M |
Scaffold ID | SL_4KL_010_BRINEDRAFT_10192255 Open in IMG/M |
Source Dataset Name | Alkaline brine water microbial communities from Picturesque Lake, Kulunda Steppe, Russia - 4KL_010_BRINE |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 575 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Russia: Kulunda Steppe, Picturesque Lake | |||||||
Coordinates | Lat. (o) | 51.43 | Long. (o) | 79.52 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026202 | Metagenome | 198 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SL_4KL_010_BRINEDRAFT_101922551 | F026202 | N/A | MKDTVSCDAASKATVLSMGSLELLLRASVFTVLNLNEMGGTTLPRKVLGASLSRLVSCGW |
⦗Top⦘ |