NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SL_4KL_010_BRINEDRAFT_10005774

Scaffold SL_4KL_010_BRINEDRAFT_10005774


Overview

Basic Information
Taxon OID3300000575 Open in IMG/M
Scaffold IDSL_4KL_010_BRINEDRAFT_10005774 Open in IMG/M
Source Dataset NameAlkaline brine water microbial communities from Picturesque Lake, Kulunda Steppe, Russia - 4KL_010_BRINE
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)7290
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (30.77%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location NameRussia: Kulunda Steppe, Picturesque Lake
CoordinatesLat. (o)51.43Long. (o)79.52Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026202Metagenome198Y

Sequences

Protein IDFamilyRBSSequence
SL_4KL_010_BRINEDRAFT_100057743F026202GAGMKNMVFESCNAASKATMLSMGSLELLLRASVFTVLDLNEMGGTTLPWEVLGAGLSGLVSCGW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.