| Basic Information | |
|---|---|
| Taxon OID | 3300000575 Open in IMG/M |
| Scaffold ID | SL_4KL_010_BRINEDRAFT_10005190 Open in IMG/M |
| Source Dataset Name | Alkaline brine water microbial communities from Picturesque Lake, Kulunda Steppe, Russia - 4KL_010_BRINE |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7640 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (81.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russia: Kulunda Steppe, Picturesque Lake | |||||||
| Coordinates | Lat. (o) | 51.43 | Long. (o) | 79.52 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026202 | Metagenome | 198 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SL_4KL_010_BRINEDRAFT_100051901 | F026202 | GAG | MKNMVSCNTASKVTMLSIGSLELLLRASVFTVLDLNEMGGTTLPREVLGQYV* |
| ⦗Top⦘ |