NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI1357J11328_10180971

Scaffold JGI1357J11328_10180971


Overview

Basic Information
Taxon OID3300000574 Open in IMG/M
Scaffold IDJGI1357J11328_10180971 Open in IMG/M
Source Dataset NameSubsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)578
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location
Location NameS. Glens Falls, New York, USA
CoordinatesLat. (o)43.292222Long. (o)-73.604444Alt. (m)Depth (m)5.4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076441Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
JGI1357J11328_101809711F076441AGAAGGMSLFVITIFSFLAAVSLIVIFFMLPLAVQNSPQARIKRRLTAIGRMDHASRAEIRSLLKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.