| Basic Information | |
|---|---|
| Taxon OID | 3300000563 Open in IMG/M |
| Scaffold ID | SL_3KL_010_SEDDRAFT_10288336 Open in IMG/M |
| Source Dataset Name | Alkaline sediment microbial communities from Cock Soda Lake, Kulunda Steppe, Russia - 3KL_010_SED |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 641 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russia: Kulunda Steppe, Cock Lake | |||||||
| Coordinates | Lat. (o) | 52.06 | Long. (o) | 79.09 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F098192 | Metagenome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SL_3KL_010_SEDDRAFT_102883362 | F098192 | N/A | MKCPLRTDSQGNASDCYKEECAWWVIDAEIEGSNTIGACALLEVAVNGILVTIGDDEEE* |
| ⦗Top⦘ |