Basic Information | |
---|---|
Taxon OID | 3300000553 Open in IMG/M |
Scaffold ID | TBL_comb47_HYPODRAFT_10071920 Open in IMG/M |
Source Dataset Name | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1905 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Trout Bog, Vilas County, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 46.041 | Long. (o) | -89.686 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013852 | Metagenome / Metatranscriptome | 267 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TBL_comb47_HYPODRAFT_100719202 | F013852 | AGGA | MARSTFSGPILSGQNRFGPVRDVGYTDLVQTALLDFSVTAPGANYGGASGVFVASNNIPNSAATIWTPQSGVFSNSGPTKASAPTADATNLVYRGVVFYVPYSCNITDVILDIGTVPKDSAGTPVAVSAIQPYVSNNFATSTGVYATFSNISSPAAQRYTGTFVGSQLTNSNATLQDFQNPNVGQDPAWFGQIVVTLAMTTTAAGLTSGQVEVTIRYNQNDMNIGNATTYPYGNFD* |
⦗Top⦘ |