Scaffold TBL_comb47_HYPODRAFT_10039660

Overview

Basic Information

• Taxon OID: 3300000553
• Scaffold ID: TBL_comb47_HYPODRAFT_10039660
• Source Dataset Name: Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3082
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Colwellbacteria → Candidatus Colwellbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_41_28 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094999	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
TBL_comb47_HYPODRAFT_100396602	F094999	N/A	MPLTFKLSFEHFDFNDEEFLNDLKRVNHYYDNFVVLEYKENKQKVLKEFETLDDTIKYIDEHNIHFGNLILYNLDIPTLKQKFKERNL*