| Basic Information | |
|---|---|
| Taxon OID | 3300000546 Open in IMG/M |
| Scaffold ID | LJNas_1001262 Open in IMG/M |
| Source Dataset Name | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI), Lifesequencing S.L. |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3777 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sierra Nevada National Park, Granada, Spain | |||||||
| Coordinates | Lat. (o) | 36.96971 | Long. (o) | -3.46027 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077974 | Metagenome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LJNas_10012622 | F077974 | GAGG | MKPNDMPLVCLPMGLCDADVATLLDFLYELTEALERHYTGELIRRNYPRQNNSTEDSPDTNLADPPF* |
| ⦗Top⦘ |