| Basic Information | |
|---|---|
| Taxon OID | 3300000525 Open in IMG/M |
| Scaffold ID | JGI1221J11331_1086665 Open in IMG/M |
| Source Dataset Name | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 530 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Vida, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.38861 | Long. (o) | 161.931111 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038088 | Metagenome | 166 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI1221J11331_10866651 | F038088 | N/A | IFLESVMNGADPRKISRLYKLVAELHEFSNGEPDPSDWAEIVDIVLSEYKYRPVALGESITAAKTMAEYMYPKRKQVDLNGGSGAGGDVGQSPLTAEEVELFREKFNDWF* |
| ⦗Top⦘ |