Basic Information | |
---|---|
Taxon OID | 3300000510 Open in IMG/M |
Scaffold ID | Foulum_1034811 Open in IMG/M |
Source Dataset Name | Anaerobic digester microbial communities from Northern Denmark, sample from Foulum manure |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Aalborg University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1063 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Soeholt, Denmark | |||||||
Coordinates | Lat. (o) | 56.496244 | Long. (o) | 9.599689 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038199 | Metagenome | 166 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Foulum_10348112 | F038199 | GAGG | MQYTQAEFLQIIKQYNSTDRKVIKANLKRIMHIYGIKPADIISLGYSPRNVYAWTNKSTNNIPLFEQALNIAVHFDFSIIEFIK* |
⦗Top⦘ |