NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Foulum_1008782

Scaffold Foulum_1008782


Overview

Basic Information
Taxon OID3300000510 Open in IMG/M
Scaffold IDFoulum_1008782 Open in IMG/M
Source Dataset NameAnaerobic digester microbial communities from Northern Denmark, sample from Foulum manure
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAalborg University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1315
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark

Source Dataset Sampling Location
Location NameSoeholt, Denmark
CoordinatesLat. (o)56.496244Long. (o)9.599689Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059780Metagenome133Y

Sequences

Protein IDFamilyRBSSequence
Foulum_10087822F059780AGGAGGMIYLIGIKKGVHPCGNAGTFITRYKAEYKLREAAKQFAAMYNLDEVYGLEIYSQKLCEYNNTEFVNYIRRNCKRYV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.