| Basic Information | |
|---|---|
| Taxon OID | 3300000506 Open in IMG/M |
| Scaffold ID | Soeholt_1000044 Open in IMG/M |
| Source Dataset Name | Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aalborg University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 56298 |
| Total Scaffold Genes | 52 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 46 (88.46%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Soeholt, Denmark | |||||||
| Coordinates | Lat. (o) | 57.363486 | Long. (o) | 10.268131 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028541 | Metagenome / Metatranscriptome | 191 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Soeholt_100004434 | F028541 | AGCAGG | MNERERLKLINRLKTARTSEERDEILWYLAGQDKAARGKVQRAEPTGTGKPAPVPAPEKHPLGLPAGKLGGMGSITSLLFLFYGLVTIAAAAAKIVQGQMEGDEIKQLIMGGIFLVVGVVLFVKAKRAQRKAAEEA* |
| ⦗Top⦘ |