| Basic Information | |
|---|---|
| Taxon OID | 3300000494 Open in IMG/M |
| Scaffold ID | AAW_1002191 Open in IMG/M |
| Source Dataset Name | Anaerobic digester microbial communities from Northern Denmark, sample from West Aalborg sludge |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aalborg University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2895 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Soeholt, Denmark | |||||||
| Coordinates | Lat. (o) | 57.045078 | Long. (o) | 10.047414 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010244 | Metagenome / Metatranscriptome | 306 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| AAW_10021913 | F010244 | N/A | MTYKVKFTHSDKSRAHINCAELREGEVIYKHPRGRFVVLEFQGESGKFREAFWPEEIVKAI* |
| ⦗Top⦘ |