NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TBL_comb48_EPIDRAFT_1078200

Scaffold TBL_comb48_EPIDRAFT_1078200


Overview

Basic Information
Taxon OID3300000439 Open in IMG/M
Scaffold IDTBL_comb48_EPIDRAFT_1078200 Open in IMG/M
Source Dataset NameTrout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1017
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.0412Long. (o)-89.6864Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018323Metagenome / Metatranscriptome235N
F055419Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
TBL_comb48_EPIDRAFT_10782002F018323GAGMCNNKINDEVVELIKSLEENSVDLTSAMDTVKVLDELELPLFEHILINQICKDLNAISTEINHDQVDERVFRKIFHKVRVLKLKNPEWKFKHRAKKSTYSRKRMIEEKRLTLNQEEARELVKFEREAEIINQIKIEKSFEENRHLFKLIKESRFTRVGRRTWLSFYRFPDLRKITIYNEKNFLCKVEGIRRKYSRLKWSIVL*
TBL_comb48_EPIDRAFT_10782003F055419GAGMTETLAPHERLALYNLTDEEIEKIEEELVKHFPREEFAEIHIEVWRTYEETGALQIHKLIEAKYPGNSRAGQRAITWFKIAKVLPHRVHKNVQQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.