| Basic Information | |
|---|---|
| Taxon OID | 3300000439 Open in IMG/M |
| Scaffold ID | TBL_comb48_EPIDRAFT_1016866 Open in IMG/M |
| Source Dataset Name | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3550 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (84.62%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Trout Bog, Vilas County, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.0412 | Long. (o) | -89.6864 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050052 | Metagenome | 145 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TBL_comb48_EPIDRAFT_101686610 | F050052 | GGA | MIYTTFKQWVKSRFLEIGEPRKKAYSKDERALIEMGWGYGYDAGVLVEREQCAQIADLWSVSYPHPSKVIAETIRARGQE* |
| ⦗Top⦘ |