NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LCrCPGB2_illDRAFT_1034980

Scaffold LCrCPGB2_illDRAFT_1034980


Overview

Basic Information
Taxon OID3300000436 Open in IMG/M
Scaffold IDLCrCPGB2_illDRAFT_1034980 Open in IMG/M
Source Dataset NameSoil microbial communities from Colorado Plateau, Greene Butte sample - Light Crust, Colorado Plateau, Green Butte
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)972
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → environmental samples → uncultured Microcoleus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location NameMoab, Utah
CoordinatesLat. (o)38.714972Long. (o)-109.692944Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059598Metagenome133Y

Sequences

Protein IDFamilyRBSSequence
LCrCPGB2_illDRAFT_10349802F059598AGGAGGMKRSKNKKQGVGGRPYKWISGKTKTIRVPVAFLNQVLAFINELDRREQERKVWESSQEFIKIGHPSPQK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.