Basic Information | |
---|---|
Taxon OID | 3300000436 Open in IMG/M |
Scaffold ID | LCrCPGB2_illDRAFT_1012207 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Colorado Plateau, Greene Butte sample - Light Crust, Colorado Plateau, Green Butte |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1717 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Moab, Utah | |||||||
Coordinates | Lat. (o) | 38.714972 | Long. (o) | -109.692944 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048032 | Metagenome / Metatranscriptome | 148 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LCrCPGB2_illDRAFT_10122073 | F048032 | GGA | MDTNKQSQKQAKTLPLTQLPIVTLTAKDMSSVNGGGTQAWAG* |
⦗Top⦘ |