Scaffold LCrCPGB2_illDRAFT_1010928

Overview

Basic Information

• Taxon OID: 3300000436
• Scaffold ID: LCrCPGB2_illDRAFT_1010928
• Source Dataset Name: Soil microbial communities from Colorado Plateau, Greene Butte sample - Light Crust, Colorado Plateau, Green Butte
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1815
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location

• Location Name: Moab, Utah
• Coordinates
  • Lat. (^o): 38.714972
  • Long. (^o): -109.692944

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029653	Metagenome / Metatranscriptome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
LCrCPGB2_illDRAFT_10109281	F029653	GGCGG	MTVPDRVGTITGYRVWRVLPGQWVAPSDSLHAQTCQRSWSTTGPTLAYCPPHAQVDPNKPLMVNGPCEESPGFGCACGLYARYEPIEEEHLLPYVVGSVLAWGRVVHHAERSFFRAEKALPVAFVRPRGGSGMFPKEAEEKLYRIVEALGAGMVEDPKELRTYTEEESRKW*