| Basic Information | |
|---|---|
| Taxon OID | 3300000425 Open in IMG/M |
| Scaffold ID | P_2C_Liq_2_UnCtyDRAFT_1058556 Open in IMG/M |
| Source Dataset Name | Marine microbial community from Union City, CA, USA - Pond 2C Liquid 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 517 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eden Landing Ponds, San Francisco, CA, USA | |||||||
| Coordinates | Lat. (o) | 37.569017 | Long. (o) | -122.102433 | Alt. (m) | Depth (m) | .11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014556 | Metagenome / Metatranscriptome | 262 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| P_2C_Liq_2_UnCtyDRAFT_10585561 | F014556 | GAGG | MRESIYEVDAKYKQLAIVGRQMMDMSEYANCKGFKEEDFRLLNDMSHVGNLLTKLGNTFGPKPEDFTEADRELVARFI |
| ⦗Top⦘ |