Basic Information | |
---|---|
Taxon OID | 3300000422 Open in IMG/M |
Scaffold ID | BB_Man_A_Liq_inBBDRAFT_1000003 Open in IMG/M |
Source Dataset Name | Marine sediment microbial community from La Parguera, Puerto Rico - BB Mangrove A Sediment |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 35707 |
Total Scaffold Genes | 57 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 29 (50.88%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Bioluminescent Bay → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
Coordinates | Lat. (o) | 17.966667 | Long. (o) | -67.0 | Alt. (m) | Depth (m) | .39 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102076 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BB_Man_A_Liq_inBBDRAFT_100000313 | F102076 | AGGA | MNSARRTHQHHNARSLTTEEEYHSLKETYKLLCDLIDPKKVPAIPKPLRDRAKKCLEDYPVRRQLEQLRMTVDFFNPR* |
⦗Top⦘ |