Basic Information | |
---|---|
Taxon OID | 3300000418 Open in IMG/M |
Scaffold ID | P_2C_Liq_1_UnCtyDRAFT_1072181 Open in IMG/M |
Source Dataset Name | Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 573 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Eden Landing Ponds, San Francisco, CA, USA | |||||||
Coordinates | Lat. (o) | 37.569167 | Long. (o) | -122.1019 | Alt. (m) | Depth (m) | .13 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097996 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
P_2C_Liq_1_UnCtyDRAFT_10721812 | F097996 | GGAG | MAIIKDGMHPRYLGWQVDWPVFVKMPFSADGKHWKRREHFNWAERNLETKDIASLYAQGFIYHNTELAKENKVGDRLSEMNTEELKSLVTQLNAIVKDRTTSSQEYNNKRCKQSKIDDKQRGLIRRFLNRNPWIMDDFYHLRDHILGE* |
⦗Top⦘ |