Scaffold P_2C_Liq_1_UnCtyDRAFT_1005669

Overview

Basic Information

• Taxon OID: 3300000418
• Scaffold ID: P_2C_Liq_1_UnCtyDRAFT_1005669
• Source Dataset Name: Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3583
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Eden Landing Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.569167
  • Long. (^o): -122.1019
  • Depth (m): .13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002322	Metagenome / Metatranscriptome	571	Y

Sequences

Protein ID	Family	RBS	Sequence
P_2C_Liq_1_UnCtyDRAFT_10056691	F002322	GGA	MSKKLPYSKNVEKHILNCIQGGVGIRDMIASMQHLQDAPKSLSTMYSTYGDTIHAERARINGQVGKKVIDQALEGDFKSQELFLRSKGGWSPTQTVVEAEQDTDPEYDESAVDVMMGLLGFDSNDPDEDEQEKTNG*