| Basic Information | |
|---|---|
| Taxon OID | 3300000418 Open in IMG/M |
| Scaffold ID | P_2C_Liq_1_UnCtyDRAFT_1000060 Open in IMG/M |
| Source Dataset Name | Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 40711 |
| Total Scaffold Genes | 39 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (25.64%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eden Landing Ponds, San Francisco, CA, USA | |||||||
| Coordinates | Lat. (o) | 37.569167 | Long. (o) | -122.1019 | Alt. (m) | Depth (m) | .13 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024316 | Metagenome / Metatranscriptome | 206 | Y |
| F047638 | Metagenome / Metatranscriptome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| P_2C_Liq_1_UnCtyDRAFT_100006032 | F024316 | N/A | MKLTRILIGEILESNPGFEREIDKLKDKGATYIDSGDYGSVYLLNGKAVKVTTDEVELEHAEKLKGKKTNNFVYIYDVEVINPKLGIITMDIMGKFKGEIPEEFLHNLEKEAKSLGIDPEELDIRPDNFMVHPKSGNLKMTDV* |
| P_2C_Liq_1_UnCtyDRAFT_10000607 | F047638 | AGG | MKILNIISEIQFAVYQGMVRIGHAESITVQDIGEMLRAMPGVLTVGQVSHNSDNNTAVMKVKLLTTKPPSEAFNSFKNTSIQRIPEVKRIEIAEKTIEKKK* |
| ⦗Top⦘ |