NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LV_Brine_h2_0102DRAFT_1028624

Scaffold LV_Brine_h2_0102DRAFT_1028624


Overview

Basic Information
Taxon OID3300000405 Open in IMG/M
Scaffold IDLV_Brine_h2_0102DRAFT_1028624 Open in IMG/M
Source Dataset NameHypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1035
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica

Source Dataset Sampling Location
Location NameLake Vida, Antarctica
CoordinatesLat. (o)-77.38861Long. (o)161.931111Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F104017Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
LV_Brine_h2_0102DRAFT_10286242F104017AGGAMSNHTEHPTLTQIRQAIESNDGTYMRLRAYLGSTAYRVNGVTMNKSEMVERFKRGEL*KKRLQSGYT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.