| Basic Information | |
|---|---|
| Taxon OID | 3300000405 Open in IMG/M |
| Scaffold ID | LV_Brine_h2_0102DRAFT_1012916 Open in IMG/M |
| Source Dataset Name | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1747 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Vida, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.38861 | Long. (o) | 161.931111 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008879 | Metagenome / Metatranscriptome | 326 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LV_Brine_h2_0102DRAFT_10129162 | F008879 | AGGAGG | MATVFKKGDAVKVNTVVPQGPVLALRMDEDGVVYYRIEWTDINGTVQQRWFTEDSLIAAGE* |
| ⦗Top⦘ |