NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LV_Brine_h2_0102DRAFT_1005630

Scaffold LV_Brine_h2_0102DRAFT_1005630


Overview

Basic Information
Taxon OID3300000405 Open in IMG/M
Scaffold IDLV_Brine_h2_0102DRAFT_1005630 Open in IMG/M
Source Dataset NameHypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2882
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica

Source Dataset Sampling Location
Location NameLake Vida, Antarctica
CoordinatesLat. (o)-77.38861Long. (o)161.931111Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094521Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
LV_Brine_h2_0102DRAFT_10056303F094521GAGGMSAGKFDLDGKYESDAGNVYRCRPQPETKALALDSVVNAYPAGTITAGLGSVTLTKSKRSLGVIPRTVTVRFTEDGTGDQGDYEGDGTSHVVVVFNPTTFAGYAIGDTGTYLGIACTLDFKSPEVLR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.