| Basic Information | |
|---|---|
| Taxon OID | 3300000401 Open in IMG/M |
| Scaffold ID | BB_Man_B_Liq_inBBDRAFT_1034798 Open in IMG/M |
| Source Dataset Name | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 566 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 17.966667 | Long. (o) | -67.0 | Alt. (m) | Depth (m) | .39 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050952 | Metagenome / Metatranscriptome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BB_Man_B_Liq_inBBDRAFT_10347981 | F050952 | GAGG | MQNTQTNNYVFLTAANAAIAVHVNNVVVATDVQTADALVQVFLTHNINVLT |
| ⦗Top⦘ |