NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BB_Man_B_Liq_inBBDRAFT_1023142

Scaffold BB_Man_B_Liq_inBBDRAFT_1023142


Overview

Basic Information
Taxon OID3300000401 Open in IMG/M
Scaffold IDBB_Man_B_Liq_inBBDRAFT_1023142 Open in IMG/M
Source Dataset NameMarine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)746
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location NameBioluminescent Bay, La Paraguera, Puerto Rico
CoordinatesLat. (o)17.966667Long. (o)-67.0Alt. (m)Depth (m).39
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093765Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
BB_Man_B_Liq_inBBDRAFT_10231422F093765N/AKEAFYELMEYGFGEYEDPNEIEFLAEEVCFSIDPEDGTLQMTLDTGIASILKPMEGEMRAQITNDHEMAATSAIYDRLITAIVEANPAFEGNIALCSPPTPGNSYLRSEDGERFEGAFHLLTDPESQYAFNVDIIDVNADILKATYKPI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.