Scaffold CisS_allDRAFT_1002010

Overview

Basic Information

• Taxon OID: 3300000398
• Scaffold ID: CisS_allDRAFT_1002010
• Source Dataset Name: Hypoxic/sulfidic aquatic microbial communities from Cistern Spring, Yellowstone National Park, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3552
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Yellowstone National Park, Wyoming
• Coordinates
  • Lat. (^o): 44.7230812
  • Long. (^o): -110.7040247
  • Depth (m): 9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051572	Metagenome / Metatranscriptome	144	N

Sequences

Protein ID	Family	RBS	Sequence
CisS_allDRAFT_10020103	F051572	GAGG	MGSGRVHGGPFADVRTFADVVLEGGCKRSLQFLKARLDLCVLAALVKAVPAGSMVKLRPGLVWRLAEELAAAAGRDRERVRNALLKRAGEVLARLRRELGDKAPAEALLARLAELFLEELEA*