| Basic Information | |
|---|---|
| Taxon OID | 3300000397 Open in IMG/M |
| Scaffold ID | ConS_8084CDRAFT_1000347 Open in IMG/M |
| Source Dataset Name | Hot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - C T=80-84 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5031 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (41.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Conch Spring, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.5564135 | Long. (o) | -110.8321631 | Alt. (m) | Depth (m) | 2194.56 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100050 | Metagenome / Metatranscriptome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ConS_8084CDRAFT_10003477 | F100050 | GGTGG | MDDVFFPMDVIVRYMLATLLALVGGLVGFYLIPYEPFGAVGNVLFMGALFGFIAGFLGFTGFFGNVVNAFLVSFILWFVLPGQWFVIWTGGNAGYMVGNVLGQLGRLSAVKKIEAEAL* |
| ⦗Top⦘ |