Scaffold WOR_120174

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold WOR_120174

Scaffold WOR_120174

Overview

Basic Information
Taxon OID	3300000393 Open in IMG/M
Scaffold ID	WOR_120174 Open in IMG/M
Source Dataset Name	GB background transcript assembly
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Pennsylvania State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	560
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California

Source Dataset Sampling Location
Location Name	Guaymas Basin, Gulf of California
Coordinates	Lat. (^o)	27.506	Long. (^o)	-111.347	Alt. (m)		Depth (m)	1990
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102444	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
WOR_1201741	F102444	N/A	LIILAVVTVLFIPVFIWSTGLTAETKSFWEISGLIATERIVVEEVNLRANVTSCTIYVRNIGKTAIIVDNVFISSPDGSLYKFEESQFSTDFDSVVQGDLMTVGIPDLGFIPTGGETYTVKVFTTRGVGDTYQVVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.