| Basic Information | |
|---|---|
| Taxon OID | 3300000393 Open in IMG/M |
| Scaffold ID | WOR_116090 Open in IMG/M |
| Source Dataset Name | GB background transcript assembly |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 648 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guaymas Basin, Gulf of California | |||||||
| Coordinates | Lat. (o) | 27.506 | Long. (o) | -111.347 | Alt. (m) | Depth (m) | 1990 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093179 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| WOR_1160902 | F093179 | GGAG | MKKALLYVATAILLGTVTMVAPLMLLKPRYFEAITRGSPASLETLDKGEGTYGDVGALERAISPPNLSSAGLIFIPGFLLALGVSLYLKKRMYS* |
| ⦗Top⦘ |